SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484239|ref|YP_005393152.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484239|ref|YP_005393152.1|
Domain Number 1 Region: 87-318
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 5.63e-58
Family MurCDEF 0.00027
Further Details:      
 
Domain Number 2 Region: 322-472
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 9.29e-44
Family MurCDEF C-terminal domain 0.0000764
Further Details:      
 
Domain Number 3 Region: 7-87
Classification Level Classification E-value
Superfamily MurE/MurF N-terminal domain 1.24e-18
Family MurE/MurF N-terminal domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383484239|ref|YP_005393152.1|
Sequence length 479
Comment UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [Rickettsia parkeri str. Portsmouth]
Sequence
MSHNLKQLFQQHNVKGLSINSKTVKDKDIFFAIKGRNTDGNDFIKDALSKGAVLVITDNK
KNIVIDKVIYVKDVQAALYEAIEIFYPKKPKDLIAVTGTNGKSSVVSYIAQTYSLLGKKA
ASIGTIGVEIFGCVNLINDVPELTTLDYLSFRKIAHNLAENGIEYLVFEASSHGLDQARL
REIKVNIACFTSFSQDHLDYHHTKENYLLAKLKLFINHLLPNGIAILNSDIEEIEFVKDY
LHNHNIKFITVGTKGDLEITRLNGSLKGQNINFTFNNREYNFNTPIIGSFQASNLLIAVL
SIHYIGFAFDDVIDSLVEVKAVKGRMERIDNTNIFVDYAHTPDALEKALTELKNIKLRDS
KLSVIFGCGGNRDKAKRSLMGQIAAKRADTIIITDDNPRHEDPKLIRAEIISGIEKADYT
EIANREEAIKYGINNLKQDDILLVAGKGHENYQIIGDKKLPFDDAEVVRKCVKVCHPVA
Download sequence
Identical sequences A0A0F3QP17
gi|383484239|ref|YP_005393152.1| WP_014410898.1.24793 WP_014410898.1.3533 WP_014410898.1.42246 WP_014410898.1.49683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]