SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484253|ref|YP_005393166.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484253|ref|YP_005393166.1|
Domain Number 1 Region: 1-42
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000011
Family N-acetyl transferase, NAT 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383484253|ref|YP_005393166.1|
Sequence length 52
Comment Acetyltransferase [Rickettsia parkeri str. Portsmouth]
Sequence
MQKVEDLARERGCNFIHLVTMDCKAKSFYEKLGFAMHGCEKDSIMYYLRKNL
Download sequence
Identical sequences A0A0F3QR72
WP_014410907.1.24793 WP_014410907.1.3533 WP_014410907.1.42246 WP_014410907.1.49683 gi|383484253|ref|YP_005393166.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]