SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484267|ref|YP_005393180.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484267|ref|YP_005393180.1|
Domain Number 1 Region: 2-256
Classification Level Classification E-value
Superfamily CorA soluble domain-like 2.35e-29
Family CorA soluble domain-like 0.016
Further Details:      
 
Domain Number 2 Region: 254-317
Classification Level Classification E-value
Superfamily Magnesium transport protein CorA, transmembrane region 8.76e-21
Family Magnesium transport protein CorA, transmembrane region 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383484267|ref|YP_005393180.1|
Sequence length 319
Comment magnesium/nickel/cobalt transporter CorA [Rickettsia parkeri str. Portsmouth]
Sequence
MITTYLKENSSIVKNAEYIINESTLWIDLFNITDEEKVIVKNTLNIEIPTLKDISQIEIS
ERLYVENEALYLTITELVNKEQEFPETHSIVFILHKCCLITVRYVELIPFNDCINKFAKQ
LNNKHNAENILFMLLRNMVTRLSNIVQSISMDIDDYGRLILDNNINDLRIDHTNVLKKIG
RKGDLLSKSRECLFSLTMAIQYILKSPQITHNKASKDLLDTLLRDVDSIINFSQFISSEI
ARTLDAALGMIAIEQNNIIKIFSLVTIFFLPPTLIASIYGMNFTVMPELKSPYGYPIALF
LMLLSTIITYKYFKKRKWL
Download sequence
Identical sequences A0A0F3QNF6 C3PP55 Q92H29
gi|15892866|ref|NP_360580.1| gi|229586957|ref|YP_002845458.1| gi|383484267|ref|YP_005393180.1| WP_010977540.1.22823 WP_010977540.1.23845 WP_010977540.1.24793 WP_010977540.1.29537 WP_010977540.1.29763 WP_010977540.1.33163 WP_010977540.1.3533 WP_010977540.1.42246 WP_010977540.1.47675 WP_010977540.1.49683 272944.RC0943 347255.RAF_ORF0852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]