SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484297|ref|YP_005393210.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484297|ref|YP_005393210.1|
Domain Number 1 Region: 1-181
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.38e-44
Family Ribonuclease PH domain 1-like 0.00000616
Further Details:      
 
Domain Number 2 Region: 154-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.57e-22
Family Ribonuclease PH domain 2-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383484297|ref|YP_005393210.1|
Sequence length 239
Comment ribonuclease PH [Rickettsia parkeri str. Portsmouth]
Sequence
MRQSGRKSNQLRPISLELSPLINAEGSCLIKIGNTHVMCSATCETTVPPFLRGQNQGWIT
AEYGMLPGSTSQRIKREAALGKQGGRTQEIQRLIGRAMRCVIDVRKLGERQIIIDCDVIN
ADGGTRTAAITGSYVALHLAIRSLMKKRVLKVNPLISQIAAISCGIYKGEAILDLDYLED
SDADVDSNFVFAGNGNLIEVQGTAEKNPFSEEQFLAMLKLAKGGAAELFKLQNQVLLGS
Download sequence
Identical sequences A0A0F3QPQ7 C3PP75 C4K2U2 H8LMQ0 Q92GZ7
gi|229586977|ref|YP_002845478.1| gi|238651083|ref|YP_002916941.1| 272944.RC0975 347255.RAF_ORF0877 562019.RPR_07315 WP_010977568.1.23845 WP_010977568.1.24793 WP_010977568.1.29537 WP_010977568.1.29763 WP_010977568.1.33163 WP_010977568.1.3533 WP_010977568.1.42246 WP_010977568.1.49683 WP_010977568.1.54264 WP_010977568.1.55704 WP_010977568.1.93503 gi|15892898|ref|NP_360612.1| gi|383751610|ref|YP_005426711.1| gi|383484297|ref|YP_005393210.1| gi|374319573|ref|YP_005066072.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]