SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484310|ref|YP_005393223.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484310|ref|YP_005393223.1|
Domain Number 1 Region: 1-119
Classification Level Classification E-value
Superfamily Prokaryotic ribosomal protein L17 5.36e-47
Family Prokaryotic ribosomal protein L17 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383484310|ref|YP_005393223.1|
Sequence length 136
Comment 50S ribosomal protein L17 [Rickettsia parkeri str. Portsmouth]
Sequence
MRHKIKGRKLNVTSSHRQAMLANMAIALVTHEQIKTTLPKAKELRPYIETLITKAKKADL
MVRRSVLSKIKDKTAVEKLINILGTRYKDRPGGYTRIIKAGFRYGDLAPIAYIEFVDRDI
NAKGNIQQDANEEIKN
Download sequence
Identical sequences A0A0F3QMR7
gi|383484310|ref|YP_005393223.1| WP_014410946.1.24793 WP_014410946.1.3533 WP_014410946.1.42246 WP_014410946.1.49683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]