SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484410|ref|YP_005393323.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484410|ref|YP_005393323.1|
Domain Number 1 Region: 3-154
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.64e-50
Family Glutathione peroxidase-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383484410|ref|YP_005393323.1|
Sequence length 156
Comment Bacterioferritin comigratory protein [Rickettsia parkeri str. Portsmouth]
Sequence
MTLELGKKLPDLSLHIGQDNVIKLSDLKGKFVILYFYPKDDTPGCTIEAQDFNKLKPEFD
KLNTVIIGVSKDKLDSHDKFKEKYSLGFDLASDANSNLCEQLGVWIEKSMFGKKYMGIDR
ATFLLDKEGIVKHIWRSVNAKNHAQEVLEKLRTMLS
Download sequence
Identical sequences A0A0F3QQ76 A0A0H3AYH3 A0A162VK97 B0BUY5 C4K0S6 H6PV08 H8LNV3 Q7P9K7 Q9AKF1
gi|165933662|ref|YP_001650451.1| gi|238650373|ref|YP_002916225.1| gi|379019554|ref|YP_005295788.1| gi|378724455|ref|YP_005289339.1| gi|383484410|ref|YP_005393323.1| gi|374319651|ref|YP_005066150.1| gi|378721755|ref|YP_005286642.1| gi|379018241|ref|YP_005294476.1| gi|379016000|ref|YP_005292235.1| gi|157828938|ref|YP_001495180.1| gi|383751705|ref|YP_005426806.1| 392021.A1G_06060 452659.RrIowa_1301 562019.RPR_01345 gi|378723102|ref|YP_005287988.1| WP_004997602.1.16657 WP_004997602.1.17801 WP_004997602.1.24793 WP_004997602.1.31136 WP_004997602.1.3339 WP_004997602.1.3533 WP_004997602.1.38731 WP_004997602.1.42246 WP_004997602.1.4490 WP_004997602.1.49683 WP_004997602.1.54113 WP_004997602.1.54264 WP_004997602.1.55704 WP_004997602.1.74071 WP_004997602.1.76853 WP_004997602.1.77680 WP_004997602.1.78650 WP_004997602.1.81845 WP_004997602.1.83836 WP_004997602.1.89241 WP_004997602.1.93503 WP_004997602.1.95812 gi|379712823|ref|YP_005301162.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]