SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484412|ref|YP_005393325.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484412|ref|YP_005393325.1|
Domain Number 1 Region: 46-149
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000636
Family Extended AAA-ATPase domain 0.068
Further Details:      
 
Weak hits

Sequence:  gi|383484412|ref|YP_005393325.1|
Domain Number - Region: 224-314
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.059
Family beta-glycanases 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383484412|ref|YP_005393325.1|
Sequence length 321
Comment tetraacyldisaccharide 4'-kinase [Rickettsia parkeri str. Portsmouth]
Sequence
MIKLLYPEFWQKRNIIAYLLLPISVIYQFLGYLRASLARPIMLPAKVICVGNCSVGGTGK
TQIVMYLAKLLKARNVSFVIVTKAYGSNLKSATTIHQGHTALEVGDEGVILAKYGAVIAT
KNIKEIVPLLNELKPDIIIVDDFLQNPYFHKDFTIVSVDSQRLFGNGFLIPAGPLRQYPN
KVLDAADLIFLVSSHQDKIPNILTPYVNKLINAQIVPSNNIDKTKNYFAFSGIGNPERFF
ATLKNYGLNITGYKIFPDHYNYLQADLENLYSLAKEHNATLVTTRKDHVKFNDLNNNIVC
LDVELSINHPDLLNEKIFKKA
Download sequence
Identical sequences A0A0F3QRN3
gi|383484412|ref|YP_005393325.1| WP_014411007.1.24793 WP_014411007.1.3533 WP_014411007.1.42246 WP_014411007.1.49683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]