SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484425|ref|YP_005393338.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484425|ref|YP_005393338.1|
Domain Number 1 Region: 3-114
Classification Level Classification E-value
Superfamily SspB-like 7.06e-36
Family AGR C 3712p-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383484425|ref|YP_005393338.1|
Sequence length 157
Comment hypothetical protein MC1_06195 [Rickettsia parkeri str. Portsmouth]
Sequence
MNIEYKKFVHEYMLEFVKKILTKIQHENLYWDQLIYISYRTDNPAVILPSKVKQAYPKQI
TIVLQYQFENLIVNDTGFSLTVSFDGVKEIIYVPFDALISFVDSNNNYSLTFNQSLNIHE
NPQHEEAISNNKSDQTSSSSSPNVIMLDKFRNSSKPS
Download sequence
Identical sequences A0A0F3QNC0 H8LPS0 Q7P9M1
gi|374319682|ref|YP_005066181.1| gi|383484425|ref|YP_005393338.1| WP_004997576.1.24793 WP_004997576.1.29763 WP_004997576.1.3533 WP_004997576.1.42246 WP_004997576.1.47675 WP_004997576.1.49683 WP_004997576.1.54264 WP_004997576.1.55704 WP_004997576.1.95812 gi|383751746|ref|YP_005426847.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]