SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484478|ref|YP_005393391.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|383484478|ref|YP_005393391.1|
Domain Number - Region: 3-38
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0109
Family SinR domain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383484478|ref|YP_005393391.1|
Sequence length 118
Comment hypothetical protein MC1_06515 [Rickettsia parkeri str. Portsmouth]
Sequence
MSSMLKQIRLDSGKTLNQVSSDLKIRKKYLVALEEGDFDVLPGEVYVRGYLKLYLDYLNV
KDRNAEQIEEATKQNETEKLLNNKRAMVINYKRKKQLVLISIIMLSIIIVSHPFIINA
Download sequence
Identical sequences A0A0F3QR41
WP_014411049.1.24793 WP_014411049.1.3533 WP_014411049.1.42246 WP_014411049.1.49683 gi|383484478|ref|YP_005393391.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]