SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484493|ref|YP_005393406.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484493|ref|YP_005393406.1|
Domain Number 1 Region: 5-71
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000101
Family SinR domain-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383484493|ref|YP_005393406.1|
Sequence length 78
Comment hypothetical protein MC1_06610 [Rickettsia parkeri str. Portsmouth]
Sequence
MALATKVKEFLEEKLKQEKIDRKYLAEVTNIPYTTVSRIMRAEANREFNPEIDTILKIAK
YFNCTMDEVIKRKVQNNS
Download sequence
Identical sequences A0A0F3MZL1 A0A0F3PDP9 A0A0F3Q9E3 A0A0F3QPJ4 A0A0H3AVX3 A0A126EAL9 B0BV74 H6PV92 H6QHZ0 H8K316 H8KCY3 H8LQA7 Q7P9U1
392021.A1G_06540 452659.RrIowa_1400 gi|378721836|ref|YP_005286723.1| gi|379713412|ref|YP_005301750.1| WP_004997409.1.11483 WP_004997409.1.13177 WP_004997409.1.13280 WP_004997409.1.16657 WP_004997409.1.17801 WP_004997409.1.22172 WP_004997409.1.22823 WP_004997409.1.23845 WP_004997409.1.24793 WP_004997409.1.29537 WP_004997409.1.29763 WP_004997409.1.31136 WP_004997409.1.32498 WP_004997409.1.33163 WP_004997409.1.3339 WP_004997409.1.34408 WP_004997409.1.3533 WP_004997409.1.38731 WP_004997409.1.41615 WP_004997409.1.42246 WP_004997409.1.4490 WP_004997409.1.47675 WP_004997409.1.49683 WP_004997409.1.54264 WP_004997409.1.55704 WP_004997409.1.59258 WP_004997409.1.61150 WP_004997409.1.62561 WP_004997409.1.64976 WP_004997409.1.67882 WP_004997409.1.73007 WP_004997409.1.74071 WP_004997409.1.75615 WP_004997409.1.76853 WP_004997409.1.77680 WP_004997409.1.78650 WP_004997409.1.81845 WP_004997409.1.81875 WP_004997409.1.83836 WP_004997409.1.89241 WP_004997409.1.95812 WP_004997409.1.97013 gi|378723181|ref|YP_005288067.1| gi|383482057|ref|YP_005390972.1| gi|379015918|ref|YP_005292153.1| gi|379712907|ref|YP_005301246.1| gi|378724535|ref|YP_005289419.1| gi|165933751|ref|YP_001650540.1| gi|379019636|ref|YP_005295870.1| gi|383313115|ref|YP_005365916.1| gi|383482661|ref|YP_005391575.1| gi|383484493|ref|YP_005393406.1| gi|374319739|ref|YP_005066238.1| gi|157829027|ref|YP_001495269.1| gi|379018321|ref|YP_005294556.1| gi|383751814|ref|YP_005426915.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]