SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484502|ref|YP_005393415.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484502|ref|YP_005393415.1|
Domain Number 1 Region: 99-301
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.34e-48
Family Nitrogenase iron protein-like 0.00000394
Further Details:      
 
Domain Number 2 Region: 3-80
Classification Level Classification E-value
Superfamily Domain of the SRP/SRP receptor G-proteins 7.2e-17
Family Domain of the SRP/SRP receptor G-proteins 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383484502|ref|YP_005393415.1|
Sequence length 303
Comment signal recognition particle-docking protein FtsY [Rickettsia parkeri str. Portsmouth]
Sequence
MISIFSKLKQSLSKTSNKISEGIDKIFYKKKLDAGTLEELEELLISSDMSVLVVTNIIEE
FKKVKFDKEIDSDTVKEALAKLIEQQLSKSAIPFTLSENKLNVILVCGVNGAGKTTTIGK
LAAMYSAQGKKVAVAACDTFRAAAVNQLSTWADRANALLITGEESADPASVAYRGMEESI
KQNIDILFIDTAGRLHNKKNLMDELSKIVKVIKKLDENAPTHSVLVIDAITGQNTYNQVE
HFNDATNLTGLIVTKLDSSAKAGVIVGVVQKFNLPLYFIGIGEKIEDLKIFNQHDFARNL
VGL
Download sequence
Identical sequences A0A0F3QN74
gi|383484502|ref|YP_005393415.1| WP_014411067.1.24793 WP_014411067.1.3533 WP_014411067.1.42246 WP_014411067.1.49683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]