SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484508|ref|YP_005393421.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484508|ref|YP_005393421.1|
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.1e-47
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.00019
Further Details:      
 
Domain Number 2 Region: 302-426
Classification Level Classification E-value
Superfamily UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 1.28e-35
Family UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 0.0022
Further Details:      
 
Domain Number 3 Region: 196-289
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 6.46e-30
Family UDP-glucose/GDP-mannose dehydrogenase dimerisation domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383484508|ref|YP_005393421.1|
Sequence length 432
Comment UDP-glucose 6-dehydrogenase [Rickettsia parkeri str. Portsmouth]
Sequence
MNITFIGSGYVGLVSGIIMGYLGHDVTCLDNDEVKISKLNKQILPIYEAKLDEYLKQALE
SDRLKFTNIYNNELQNADAIFITVGTPSKGLGEADLKYVYDAIDKVFEHINKDCLIVIKS
TVPPGSCSNIIAYLKSRGFSFNVASNPEFLREGSAVEDFLYPDRIVIGVNNKESEEILRK
IYAPLQGVKFVVTDLVTSELIKYASNSFLATKIAFINEMADLCEKIGGNIKDLSKGVGLD
QRIGQNFLNAGPGFGGSCFPKDILALNNLVENHHIDCRILKAVIKSNKQRPSNMVDKIAT
LLDGDLKGKNIAILGLTYKAGTDDVRASPAIAIVKILLNKDVYVKAFDPIGLENAKKNLE
HKNLLYLDSAVDACKSVDIIVIATEWSEFKELNWQEIYDLVKSPIIIDFRNILDNEAMKK
IGFRYYAVGSKI
Download sequence
Identical sequences A0A0F3QPT7
WP_014411073.1.24793 WP_014411073.1.3533 WP_014411073.1.42246 WP_014411073.1.49683 gi|383484508|ref|YP_005393421.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]