SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484519|ref|YP_005393432.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484519|ref|YP_005393432.1|
Domain Number 1 Region: 163-205
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000104
Family SinR domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383484519|ref|YP_005393432.1|
Sequence length 221
Comment Putative transcriptional regulator [Rickettsia parkeri str. Portsmouth]
Sequence
MSKKLISVVELPEFQKFAKNNLNEKECFEIIHYIAANPDQGDIIKGTGGIRRKLRFTLSS
NNKGKSGSIRIIYFYYNENMPVFLITGFIKSKMENINHNSCNELKKLTEELENYMSDEAK
INNKNTNQTDKSILIGMQEAVLYTKGKLKANKHDIKLSNIDVHKARDKLKLTQQQFATTF
GVSVATLRNWEQGRRLPTGAAKLLLKIIEKEPNVVKRVLRG
Download sequence
Identical sequences WP_014411083.1.24793 WP_014411083.1.3533 WP_014411083.1.42246 WP_014411083.1.49683 gi|383484519|ref|YP_005393432.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]