SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383484533|ref|YP_005393446.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484533|ref|YP_005393446.1|
Domain Number 1 Region: 96-378
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.68e-103
Family RecA protein-like (ATPase-domain) 0.0000000013
Further Details:      
 
Domain Number 2 Region: 380-508
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 1.83e-45
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0000339
Further Details:      
 
Domain Number 3 Region: 10-93
Classification Level Classification E-value
Superfamily N-terminal domain of alpha and beta subunits of F1 ATP synthase 1.28e-25
Family N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383484533|ref|YP_005393446.1|
Sequence length 510
Comment F0F1 ATP synthase subunit alpha [Rickettsia parkeri str. Portsmouth]
Sequence
MKLKPIEVAEILQKEIANINCLSELEEVGQVITVGDGIAQIYGLANVKSGEVVEFKSGVK
GLVLNLENDSVGAVIMGDDNQVQQGDNVKRTKAVLGVPVGKALLGRVVDALGNPIDGKGD
IASKEYRHIEMKAPGIIERTSVSEPVQTGIKAIDSLIPIGRGQRELIIGDRQTGKTAIAV
DTIINQKQAHSLTNESDKIYCIYVAIGQKRSSVAQIVKKLEDAGAMDYTLIVSATASEAA
ALQFIAPYSACSMGEYFRDNGMHALIIYDDLSKHAVAYRQISLLLRRPPGREAYPGDVFY
LHSRLLERAAKMSEEKGSGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLESELFYKG
VRPAVNVGISVSRVGSAAQIKAMKQVAGSVKLELAQFRELESFSQFGSDLDPATKAQIDH
GKRLVEILKQAQYHPFPVEEQIVSIYVGTKKYLNDVPLQKVKEFEDKMLTEIRLNKKDIL
ESIKNEQRITEETEQKLKAFLENFVKEFVK
Download sequence
Identical sequences A0A0F3QS47
gi|383484533|ref|YP_005393446.1| WP_014411094.1.24793 WP_014411094.1.3533 WP_014411094.1.42246 WP_014411094.1.49683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]