SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383484538|ref|YP_005393451.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484538|ref|YP_005393451.1|
Domain Number 1 Region: 7-89
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 0.000000000668
Family beta-Lactamase/D-ala carboxypeptidase 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383484538|ref|YP_005393451.1|
Sequence length 90
Comment beta-lactamase [Rickettsia parkeri str. Portsmouth]
Sequence
MKIIKQEGNCESRYAPCSTFKIAICLMGYDDGFLIDETHPKLPVKEGYADYLEVWKQSQT
PKDWMKNSCVWYSQIITKELDMEKFRDYVT
Download sequence
Identical sequences A0A0F3QPG4
gi|383484538|ref|YP_005393451.1| WP_014411096.1.24793 WP_014411096.1.3533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]