SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484567|ref|YP_005393480.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484567|ref|YP_005393480.1|
Domain Number 1 Region: 340-648
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.66e-45
Family RecA protein-like (ATPase-domain) 0.042
Further Details:      
 
Domain Number 2 Region: 680-742
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.72e-19
Family FtsK C-terminal domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383484567|ref|YP_005393480.1|
Sequence length 744
Comment cell division protein FtsK [Rickettsia parkeri str. Portsmouth]
Sequence
MLYYINKILSNNKVQAVILGIIGLGIVTVLTSYNIDDPSFNSVTTEYHSNLVGIFGSYLS
DCLYQFFGLAAFIIPLACFVWGRNCWYGRYRGSFIRMFVMLLALVSSSTLLSKIKLEFIP
ANAGGAIGIIASNFFERFTNQLYLLLIFFTFIILVVLFEIKFTSLSNFIIKLGKFLIYRI
QSFLHNVFSRLSSIRLFPTKNNDKINITSSYQKPVSEKVKFPEEARSVPANPIKFFSKPV
SPKISQSEIAELPPISLLRDPEKHHVKGASSSELKQKAEELLTVLNDFGVKGQIININQG
PVVTQYEFEPAAGTKTSRVVGLSDDIARSLSALSTRIAVIPGKNVLGIELPNKQREFFCL
KELIETPEYQDKSTLLPLVLGKDLAGKPLIADLAKMPHLLVAGTTGSGKSVGINVMIVSL
LYRYTPEECRFIMIDPKMLELSAYDGIPHLLTPVVTEPSKAVVALKWAVKEMENRYRMMS
NIGVKNIAGYNAKILEAVKENRVIERSIQTGFDPETGKPIYETVTMNMEKLPYIVVIVDE
MADLMLVAGKDIEMLIQRLAQMARAAGIHIIMATQRPSVDVITGVIKANFPSRISFKVTS
KIDSRTILGEQGSEQLLGMGDMLFMGSTSKISRVHGPFVNEAEIEQITEYLKESGTPEYI
SAVTEQPEEDDSSIDIGDGTSDEVLYKKAVQIVRDERKSSISYIQRSLRIGYNKAANLVE
KMEKEGIVSPPNHTGKREILLPER
Download sequence
Identical sequences A0A0F3QPX2
gi|383484567|ref|YP_005393480.1| WP_014411116.1.24793 WP_014411116.1.3533 WP_014411116.1.42246 WP_014411116.1.49683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]