SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484574|ref|YP_005393487.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484574|ref|YP_005393487.1|
Domain Number 1 Region: 44-243
Classification Level Classification E-value
Superfamily OMPA-like 1.6e-19
Family Outer membrane protein 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383484574|ref|YP_005393487.1|
Sequence length 245
Comment hypothetical protein MC1_07080 [Rickettsia parkeri str. Portsmouth]
Sequence
MKKLLLIAAASTALLTSGLSFADCDMNSSVDSSTNSSMSSFVENQWYLKLNAGGVIFNKT
KPKGADFKLNNIKSNTGFTGEIGAGYYIMDNLRTDLTIGTVASSHLKKSKTYPDGNSFSV
KNKPTIVSVLLNGYVDFVDLSMFKVFAGAGVGAAFVKEKINSKDIKGGVTDTFNGTTKNK
TNFAYQLSLGTSFEVAQGVKAELVYSWRDYGKTKNTTKTINGDKVKFGGTHYKGHNLMAG
LRFDM
Download sequence
Identical sequences A0A0F3QN83 C7SRV1
gi|383484574|ref|YP_005393487.1| WP_014411121.1.24793 WP_014411121.1.3533 WP_014411121.1.42246 WP_014411121.1.49683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]