SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484593|ref|YP_005393506.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484593|ref|YP_005393506.1|
Domain Number 1 Region: 222-473
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.76e-85
Family Hsp90 middle domain 0.0000033
Further Details:      
 
Domain Number 2 Region: 3-212
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.03e-65
Family Heat shock protein 90, HSP90, N-terminal domain 0.00000714
Further Details:      
 
Domain Number 3 Region: 503-616
Classification Level Classification E-value
Superfamily HSP90 C-terminal domain 9.42e-29
Family HSP90 C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383484593|ref|YP_005393506.1|
Sequence length 621
Comment heat shock protein 90 [Rickettsia parkeri str. Portsmouth]
Sequence
MIQEKKKFDAEVGKILNLMIHSLYSNKEIFMRELISNASDACDKLRYLSQSNSELVAGDS
NFKITVKVDKDNRQIIIRDNGIGMNKDDLIENLGTIARSGTANFLKSLSGDSKKDNMLIG
QFGVGFYSSFMVADKVTVTSRKAGEDKVHIWESDGLGEYTVSDSDKEFTRGTEIVLHIKK
EEDTFLDHFRLKHIVKSYSDHIAVPIYFFDEAGNNEIQLNSASALWTRPKSEITEEQYKE
FYKSLSYAIDDPWITMHNKNEGAIEFTNLLFIPSSKTFDLFHPDRKRRVKLYIKRVFISD
ENIDLIPSYLRFLRGVVDSEDLPLNISRESLQHNSVLEKIKNAITKRVLGELRKKKEESP
EEYNKFWANFGGALKEGLCEATTNHEKLLEVCIFRSALHNKMISLDEYIANFKEGQSTIY
YLSGDNPDKLLSSPQIEGLLSKKIDVLLFTDTVDDFWVNVNSKYKEHAIKSATRSDIDVE
QTTSQSEEKNTDSKKSDDEYKLLTDYFKETLGELVKEVKISKKLTSSPACLAVSDAAMDI
RMERFLIEQKQIANASAKNLELNPKNKIIEKIFNDLKANNKNNEELVNLIFDQACILEGE
PVADTGAFSKRLNDIVQKAIL
Download sequence
Identical sequences A0A0F3QNC3 Q7PA42
WP_004997178.1.22823 WP_004997178.1.24793 WP_004997178.1.3533 WP_004997178.1.42246 WP_004997178.1.47675 WP_004997178.1.49683 WP_004997178.1.95812 gi|383484593|ref|YP_005393506.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]