SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484622|ref|YP_005393535.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484622|ref|YP_005393535.1|
Domain Number 1 Region: 4-78
Classification Level Classification E-value
Superfamily GreA transcript cleavage protein, N-terminal domain 3.53e-27
Family GreA transcript cleavage protein, N-terminal domain 0.00014
Further Details:      
 
Domain Number 2 Region: 82-157
Classification Level Classification E-value
Superfamily FKBP-like 9.29e-23
Family GreA transcript cleavage factor, C-terminal domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383484622|ref|YP_005393535.1|
Sequence length 162
Comment transcription elongation factor GreA [Rickettsia parkeri str. Portsmouth]
Sequence
MNTKFPITAKGFEKLEHELKHLKHVERKKISADIAEAREHGDLSENAEYEAAREKQAFIE
GRIKELEDMTARAEIIDIGKLSGDNIKFGATVTLIDDDTEEEVTYIIVGEYEADITRKRV
SIASPIAKALIGKSVGDFVEVTTPKGSKSYEVVTVEYKELEL
Download sequence
Identical sequences A0A0F3QM04 A0A161QQW3 H6PVU2 Q7PA71 Q92FZ5
gi|379019769|ref|YP_005296003.1| WP_004997127.1.16657 WP_004997127.1.17801 WP_004997127.1.23845 WP_004997127.1.24793 WP_004997127.1.29763 WP_004997127.1.31136 WP_004997127.1.33163 WP_004997127.1.3339 WP_004997127.1.3533 WP_004997127.1.38731 WP_004997127.1.41615 WP_004997127.1.42246 WP_004997127.1.4490 WP_004997127.1.47675 WP_004997127.1.49683 WP_004997127.1.54113 WP_004997127.1.74071 WP_004997127.1.76853 WP_004997127.1.77680 WP_004997127.1.78650 WP_004997127.1.81845 WP_004997127.1.83836 WP_004997127.1.89241 WP_004997127.1.93503 WP_004997127.1.95812 gi|379018456|ref|YP_005294691.1| gi|378724671|ref|YP_005289555.1| gi|379713040|ref|YP_005301379.1| gi|378721972|ref|YP_005286859.1| gi|379017112|ref|YP_005293347.1| gi|383484622|ref|YP_005393535.1| gi|378723316|ref|YP_005288202.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]