SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484625|ref|YP_005393538.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484625|ref|YP_005393538.1|
Domain Number 1 Region: 27-192
Classification Level Classification E-value
Superfamily Prokaryotic lipoproteins and lipoprotein localization factors 8.63e-26
Family Outer-membrane lipoproteins carrier protein LolA 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383484625|ref|YP_005393538.1|
Sequence length 212
Comment outer membrane lipoprotein-sorting protein LolA [Rickettsia parkeri str. Portsmouth]
Sequence
MKKIFFLIIIYLFVNSSLTFGADDKTAISELKTYLRKIKSVAIDFTQEDSYGKIVKGKLL
IHKPYNFRCNYYPPFPLVIIGTKNFVSMYDYDMEQVSRINRSENTFNFLLEDNEHFDKDF
VFEAVINARNISKITIYHTLTEKRSEITFNKATQQIEALKIFEDNNIVTITFDKIAKVQK
FSDDLFKIKNPEIFGPPKRLTKSEIEKKYIVS
Download sequence
Identical sequences A0A0F3QPB2 C3PM00
gi|383484625|ref|YP_005393538.1| 347255.RAF_ORF1222 gi|229587232|ref|YP_002845733.1| WP_012720105.1.24793 WP_012720105.1.29537 WP_012720105.1.3533 WP_012720105.1.42246 WP_012720105.1.49683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]