SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484465|ref|YP_005393378.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484465|ref|YP_005393378.1|
Domain Number 1 Region: 8-225
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 3.79e-70
Family Tetrapyrrole methylase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383484465|ref|YP_005393378.1|
Sequence length 281
Comment Putative methyltransferase [Rickettsia parkeri str. Portsmouth]
Sequence
MIRYLSKPGLYIVSTPIGNFEDITLRAISTLKNSDIILCEDTRISQKLLAKHDIHTKLQI
YNDHSDEKDRENIISLIKSGNIISLISDAGTPLISDPGYKLVRGIRNLNCHIDVVPGVSA
PVTALTLSALPTDRFLFHGFLPKTIESKKKIFSELVNLKATLIFFETAPRLINTLSVAKE
ILGNREICVARELTKLYQEIKTGDIDEIIEFYQNNILKGEIVLLISGNIQEQNQHKNLEK
FIELCLSKNLSSKTTTELVYDKFKDVYSKKEIYRLVNKQKI
Download sequence
Identical sequences A0A0F3QR11 H8LPW0
WP_014273773.1.24793 WP_014273773.1.3533 WP_014273773.1.42246 WP_014273773.1.49683 WP_014273773.1.54264 WP_014273773.1.55704 gi|374319712|ref|YP_005066211.1| gi|383751786|ref|YP_005426887.1| gi|383484465|ref|YP_005393378.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]