SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|526231599|ref|YP_008326599.1| from Lactobacillus reuteri TD1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|526231599|ref|YP_008326599.1|
Domain Number 1 Region: 8-270
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.78e-79
Family Protein kinases, catalytic subunit 0.00000259
Further Details:      
 
Weak hits

Sequence:  gi|526231599|ref|YP_008326599.1|
Domain Number - Region: 488-548
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00124
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.016
Further Details:      
 
Domain Number - Region: 352-399
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00471
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|526231599|ref|YP_008326599.1|
Sequence length 634
Comment protein kinase [Lactobacillus reuteri TD1]
Sequence
MNPGYEIGHRYRIIRSLGEGGMANVYLAHDMVLDRDVSVKLLRLDLRDDPSTKRRFHREA
MAATQLNDPHIVGIYDVGEDHGLQYMVMQYVKGTDLKAYIRKHYPIPFPQVIDIMEQVLS
AVATAHAYGIIHRDLKPQNILIDENKNVKITDFGIAVAVSQDSLTQTNTLMGSVHYLSPE
QARGSIATKQSDIYSLGIILFELLTGKVPFEGETAVSIALKHFREEIPSVREQNKEIPQA
LENVIIKATAKEPAERYSSVNEMAADLKTVLDPQRANEPRLKIQQDDNGETKVLDIKHLK
ADDYQPKKSTDSPIVDPSTKPQKWKKYGIVSGTLAMIVLIAVCSWWFLIRQVIIPDVEGM
TVQKAEQRLHQQNLRIGKITRVNSQAVDKNRIVSTNPDVSNKTRVSTPINLTVSTGVKQL
QMADYVGEDYSSVAANLRRKGFQVHQEPVYSDDIDKGQIIKQNHKKGTIVKPAANTIIFR
VSAGKEPIKIPNFKNQDISAVQQFANKNNLQLTTQEKKSKIIATNHVINQTPRAGSTLNH
GDTLTVSIANSGNQTKTTNIQINIPFDGNGGQRENRVQVYIRDANHNLTMEYQDITINQE
TTINVPFTLKQGQTGAYRVVRNGRTIMSATNITG
Download sequence
Identical sequences S5NBG4
gi|526231599|ref|YP_008326599.1| WP_020843148.1.56784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]