SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|522667205|ref|YP_008195667.1| from Alteromonas macleodii str. 'Ionian Sea U7'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|522667205|ref|YP_008195667.1|
Domain Number 1 Region: 193-329
Classification Level Classification E-value
Superfamily CBS-domain pair 1.19e-26
Family CBS-domain pair 0.0044
Further Details:      
 
Domain Number 2 Region: 341-426
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.45e-20
Family CorC/HlyC domain-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|522667205|ref|YP_008195667.1|
Sequence length 431
Comment hypothetical protein I876_06275 [Alteromonas macleodii str. 'Ionian Sea U7']
Sequence
MDDISTSTLFIALGVLILLSAYFSSSETGMMSINRYRLKHLQSEGNRSAIRVAKLLDRPD
RLIGLILIGNNLVNIAASSLATILCIRLFGDYWGLFAATFGLTLVLLIFAEVTPKTLAAL
YPEKIAFPSSLILLPLLTLLYPFVAAINGITNGILALLRISPANGSDDSLSREELRTVVF
EAGTMIPKKHQDMLVSILDLESVTAEDIMVPRAEIFAIDINDDWKKIQKALTHAQHTRVL
LYRDSIDDAVGFVHVRDALRLLSKDQFTKSSLLRAVREIYYTPESTPLHTLMYKFQAEKE
RIALVVDEYGDIMGLVTLEDILEEIIGDFTTSMVPDHSKEAHVQQDGSVLVDGSANVREL
NKEMNWNLPTEGPKTLNGLLLEYLEDIPENKVSVRLAGYPLEIVDISESMIKTVRIMPEY
YVPPRDSNNDG
Download sequence
Identical sequences A0A1J0SP99 S5BWC1
gi|566717817|ref|YP_008918139.1| gi|522815104|ref|YP_008183333.1| gi|522568830|ref|YP_008171259.1| gi|522667205|ref|YP_008195667.1| gi|522589330|ref|YP_008175407.1| gi|410860973|ref|YP_006976207.1| gi|522613574|ref|YP_008179264.1| WP_015066648.1.21115 WP_015066648.1.24997 WP_015066648.1.30323 WP_015066648.1.36926 WP_015066648.1.48123 WP_015066648.1.50651 WP_015066648.1.52576 WP_015066648.1.68468 WP_015066648.1.81623 WP_015066648.1.96561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]