SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|312129514|ref|YP_003996854.1| from Leadbetterella byssophila DSM 17132

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312129514|ref|YP_003996854.1|
Domain Number 1 Region: 60-161
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000914
Family Recombinase DNA-binding domain 0.079
Further Details:      
 
Domain Number 2 Region: 2-58
Classification Level Classification E-value
Superfamily TrpR-like 0.00000000282
Family SPO1678-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|312129514|ref|YP_003996854.1|
Sequence length 176
Comment transposase is3/is911 family protein [Leadbetterella byssophila DSM 17132]
Sequence
MSRKVKYDLAFKLRCVKDVLEKHQSIVRVSDSVGIKEVLLRKWLQEYEIGGLKGLEPKVS
NRTYSSSFKLNVLKAIENENLSLKDARLRFRIPSDSTIITWQRNFATFGVNGLESKPKGR
PITMNRKPKAPLTRLEELELENERLRCENAFLKKLRALIQAEEEQRRGQSQKPYKN
Download sequence
Identical sequences E4RQ18
WP_013407553.1.101163 gi|312129514|ref|YP_003996854.1| gi|312131806|ref|YP_003999146.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]