SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|312130476|ref|YP_003997816.1| from Leadbetterella byssophila DSM 17132

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312130476|ref|YP_003997816.1|
Domain Number 1 Region: 267-562
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 4.32e-78
Family DNA repair protein MutS, domain III 0.00000275
Further Details:      
 
Domain Number 2 Region: 564-800
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.67e-58
Family ABC transporter ATPase domain-like 0.000000941
Further Details:      
 
Domain Number 3 Region: 112-266
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 4.32e-38
Family DNA repair protein MutS, domain II 0.00034
Further Details:      
 
Domain Number 4 Region: 4-112
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 8.5e-38
Family DNA repair protein MutS, domain I 0.0000601
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|312130476|ref|YP_003997816.1|
Sequence length 864
Comment DNA mismatch repair protein muts [Leadbetterella byssophila DSM 17132]
Sequence
MAQTKETPLNKQYNQIKAKYPGAMLLFRVGDFYETFGEDAIKASKILGIVLTRRNNGGSN
DELAGFPHHSLDTYLPKLVRAGQRVAICDQLEDPKTVKGIVKRGVTELVTPGVSFNDNVL
DVRQNNYLASLHFASEDLIGVAFLDISTGEFFTTQGSLAYVDKLIQGFSPAEILYCKKHK
KRFEQVFGEKYNTYTFEDWVFTYDFAYDQLIQHFKTNNLKGFGVENLQEGVTAAGVILQY
LKDTEHREVDHINRLTRLDQEQYVWLDRFTIRNLELLFSPHEGGVPLIDILDQTVTPMGA
RLLRKWLVLPLKNKAQIEERLNTVQYFAGDDQVLQNLIQVLKPIGDLERLVSKVAVRRIN
PREMVQLKKALAQIEPLKELLVGHPSMEKLTGQLNDCKFLVEKIERELRDDAPTQMNQGG
MIKTGVDAPLDELHKIAFSGKDYLVDIQNRESERTGIPSLKIAYNKVFGYYLEVSNAHKD
KVPQEWIRKQTLVNAERYITEELKVYEEQILTAESKINEIEFRIFNELVLTAAEYVNVIQ
ENARVISNLDALLSFARVALKNGYARPVITEEKRLDIKGGRHPVIEQQLPTGESYVPNDL
YLDDEEQQIIIITGPNMAGKSALLRQTALIVLMAQIGSFVPAASAEVGIVDKIFTRVGAN
DNLSRGESTFMVEMTETASILNNLGDRSLVIMDEIGRGTSTYDGVSIAWSIAEYLHNHKK
QRPRTLFATHYHELNNLSNDFPRIKNFNVAVKEMNGKVVFLRKLKEGGSEHSFGIHVAQL
AGMPQSVVLRANEILQELEKSEAKEKNKAKISEAPKNNFQLNFFDPVDPVAETLKEKIKA
MDLNAMSPIEALLKLNDLQNLVKG
Download sequence
Identical sequences E4RQ88
WP_013408512.1.101163 gi|312130476|ref|YP_003997816.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]