SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|312130510|ref|YP_003997850.1| from Leadbetterella byssophila DSM 17132

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312130510|ref|YP_003997850.1|
Domain Number 1 Region: 123-277
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.44e-42
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00053
Further Details:      
 
Domain Number 2 Region: 399-561
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 4.71e-32
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0014
Further Details:      
 
Domain Number 3 Region: 7-129
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.94e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.013
Further Details:      
 
Domain Number 4 Region: 258-282,310-411
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 7.36e-16
Family Duplicated SiR/NiR-like domains 1 and 3 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|312130510|ref|YP_003997850.1|
Sequence length 696
Comment ferredoxin--nitrite reductase [Leadbetterella byssophila DSM 17132]
Sequence
MQSFRTELENPVVEQEIIELERKIREFQAGQIPEEKFRSLRLARGVYGQSQAGVQMVRIK
LPFGRVTFRQILKIADIADEYGSGNLHLTTRQDIQIHYVSLDKTPELWAKLAEDDITLRE
ACGNTVRNITASPTAGIDPDEPFDVSPYAQATFEYFLRNPICAEMGRKFKIAFSSSDKDT
AYSYVHDFGFIPKVRLENGSEVRGFKVMMGGGLGAQPMLAYEVNDFLPEDDLIPYIEATL
RIFDRHGERNNRNKARFKYLVQSKGLDEVLRLIEEEKTAIKSKTFKINRESIVQAQIPGT
PSERETPVDEAAFSLWKSTNVFEQKQKGYHGVFVKVLTGDIPTDKARTLVAGLKGYIADD
IRITQDQNLLFKFVREEALPHIYNLLHSLGYAKAGYNSTSDVTTCPGTDTCNLGISNSTE
MARVLESYIHEFHTDFVKETDLKIKISGCMNSCGQHGLAHIGFHGSSSKVGGKVVPAAQV
MLGGGTVGNGLGRVAERITKVPTKRVLQVVDVLLTDFKRNREQEENFHAYYDRQTKDYFY
QLLKPLADTSNLTDEEYVDWGHEGTFSTAIGVGECAGVIIDLVATLLLEAEEKLEWAKLA
IEKEQWADGIYHTYSSFVWTAKALLLDKGVSSRTQALVIEDFDKHYVQEGIFNFPSTFSD
RVLQINKYEPSKEFAETYLIQATAFYLEAREKRQVS
Download sequence
Identical sequences E4RQP1
WP_013408546.1.101163 gi|312130510|ref|YP_003997850.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]