SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|312131714|ref|YP_003999054.1| from Leadbetterella byssophila DSM 17132

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312131714|ref|YP_003999054.1|
Domain Number 1 Region: 298-525
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.53e-38
Family ABC transporter ATPase domain-like 0.00018
Further Details:      
 
Domain Number 2 Region: 72-294
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0000000000000288
Family DNA repair protein MutS, domain III 0.012
Further Details:      
 
Domain Number 3 Region: 725-800
Classification Level Classification E-value
Superfamily SMR domain-like 0.00000144
Family Smr domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|312131714|ref|YP_003999054.1|
Sequence length 801
Comment muts2 family protein [Leadbetterella byssophila DSM 17132]
Sequence
MLYPKNIENKLGFDKIKELLEEECVSALGRSFVAKMRFSNKYDLIRKMMAQTSEFRLILE
TESSFPNQNYLDVTEHLKRAAIPGAILYEEDFFDIRLSLTTIQQISHFFNHRPQFTELNT
LRVAAMPAHHPKGWENLLTDIHAVIDDKGKVKDNASKELYEIRRKLAVEQNNVKRALERI
YRTAKNSGWIGEDMSLTVRNGRLVLPILAEHKRKLSGFVHDETSTGNIAFVEPGEVLEAN
NEIRDLEIKERREVLRILEQLTTRLRPELPDLEKSYTFLGLMDFIRAKARLAIKTNSTFP
LLIDETIIDWQNAKHPILYLTHQKQGKNVVPLHLRLDQENRILVVSGPNAGGKSVMLKTV
GLLQYMAQCGLLVPLAPDSKVGLFRQMFIDIGDEQSIENDLSTYSSHLTNMREFLRHADR
DSLFLIDEFGTGTEPSLGGALAEAILESFREKMAFGIVNTHYTNLKVFADKNEGLINGAM
RFDAEELTPMFELEMGKPGNSFAFEVAQKMGLPPYIIKNAKKKLGKNQINFEKLLKELDI
EKKVFSEQNAALNKQIEELKQRTEQYNSLKNFLETDKTRILNQAKEEAKKIVKDANKTIE
NTIRQIKESNAEKEASRIAREQVKRFEEEKLVPEKTPHHKPVLAKAEGPIAPGDYVRIKG
QEALAQVMSINGKDAEILLGELKSNVKLNRLEKISRKEFKTAQKEGVKTMKGVDLNEKMT
EFSFNLDVRGKRGEEALVAVDQLVDDAILLGYPQLRIVHGKGDGILRTLIRNHIKQYKQV
GKMYDEHPDRGGAGVTIVDMK
Download sequence
Identical sequences E4RTZ3
gi|312131714|ref|YP_003999054.1| WP_013409733.1.101163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]