SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310817713|ref|YP_003950071.1| from Stigmatella aurantiaca DW4/3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310817713|ref|YP_003950071.1|
Domain Number 1 Region: 62-232
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 3.14e-46
Family SOUL heme-binding protein 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|310817713|ref|YP_003950071.1|
Sequence length 238
Comment soul heme-binding family protein [Stigmatella aurantiaca DW4/3-1]
Sequence
MGSLFFCGTGSPLEAGSHRSQPLVPGRGHPYPSLMNRQRQALAFGTGAALAGVLAWAGKR
MLSERAAEQPAYESLGERDGVELRQYASMAVAATHVEGAFSTSLQEGFHRLAGYLFGGNL
GEHSLAMTAPVSMQRRGAAWRMTFVMPSEFTLESLPVPLDARIRLEAVAAKRMAALRFSG
RASEEAVKAWTAELMDRLHRQRLHAVGEPILAQYHSPFMPPFLRRNEILVEVRLAAVH
Download sequence
Identical sequences E3FRQ9
WP_013374150.1.13107 WP_013374150.1.14028 gi|310817713|ref|YP_003950071.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]