SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|310818289|ref|YP_003950647.1| from Stigmatella aurantiaca DW4/3-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|310818289|ref|YP_003950647.1|
Domain Number - Region: 39-72
Classification Level Classification E-value
Superfamily EGF/Laminin 0.089
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|310818289|ref|YP_003950647.1|
Sequence length 215
Comment hypothetical protein STAUR_1016 [Stigmatella aurantiaca DW4/3-1]
Sequence
MHLPLRRSFLAACGAVLVACGDSEPAGEPPPEDPQEQEDPCAPHGHIHREAEGDWCHCDR
GYLAPEEQLVCVVDPHHVPREEGEFDFGDDGEHACWHVANGPYASVTASESRMPRVDAFH
TLYTVNLRQTAEGSTGTFQFKAFGTGDFIVYLSEHVPLTVHEGTIPVAVIAEKHTTVCTG
LQHMAGLELTEGVTYTFTLGPTSLAQLRMVTEYFP
Download sequence
Identical sequences Q08UX9
WP_002616744.1.13107 WP_002616744.1.14028 gi|310818289|ref|YP_003950647.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]