SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|310819771|ref|YP_003952129.1| from Stigmatella aurantiaca DW4/3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310819771|ref|YP_003952129.1|
Domain Number 1 Region: 8-66
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.00000000247
Family Intron-encoded homing endonucleases 0.0098
Further Details:      
 
Domain Number 2 Region: 68-91
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000497
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310819771|ref|YP_003952129.1|
Sequence length 100
Comment HNH endonuclease domain-containing protein [Stigmatella aurantiaca DW4/3-1]
Sequence
MRFQEQKGYKTFVDRTGRSQFVHRRVMEKKLGGPIRRRRVVHHINGEKGDNRPENLVAVS
RAVHSRLHGRHRNACFRCGRTSHWSSNCFAVTDFTGRPLM
Download sequence
Identical sequences E3FGG7
WP_013375273.1.13107 WP_013375273.1.14028 gi|310819771|ref|YP_003952129.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]