SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|310821170|ref|YP_003953528.1| from Stigmatella aurantiaca DW4/3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310821170|ref|YP_003953528.1|
Domain Number 1 Region: 680-823
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 1.01e-16
Family Lamin A/C globular tail domain 0.0069
Further Details:      
 
Domain Number 2 Region: 572-617
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000573
Family EGF-type module 0.035
Further Details:      
 
Domain Number 3 Region: 399-458
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000706
Family Rhamnogalacturonase B, RhgB, middle domain 0.014
Further Details:      
 
Domain Number 4 Region: 231-291
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000942
Family Carboxypeptidase regulatory domain 0.032
Further Details:      
 
Domain Number 5 Region: 52-110
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000667
Family Rhamnogalacturonase B, RhgB, middle domain 0.02
Further Details:      
 
Domain Number 6 Region: 141-224
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000377
Family Carboxypeptidase regulatory domain 0.042
Further Details:      
 
Weak hits

Sequence:  gi|310821170|ref|YP_003953528.1|
Domain Number - Region: 490-543
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000173
Family Carboxypeptidase regulatory domain 0.036
Further Details:      
 
Domain Number - Region: 620-684
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.000445
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.026
Further Details:      
 
Domain Number - Region: 316-398
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000785
Family Pre-dockerin domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310821170|ref|YP_003953528.1|
Sequence length 868
Comment hypothetical protein STAUR_3913 [Stigmatella aurantiaca DW4/3-1]
Sequence
MQLTVSTRSRSAEASPSLQPFNDKVPMPVHALLCQTALVAMVLVSLPGAAWAQAALSGQV
KFSDGSIASGVTVYARVPSSTLAYRTTADAAGMYSLQLIPGTYNVGVDFAFHNFSGMETL
VSAQSISTPTTLNLTAHDIQLNGRVVNSSGQPVANVRLWGEAVSGGYDSDREVSPVSGAD
GRFQVRMLPGDYSSMQLEPPTGGPYVITPLPNQAFSSNTTQDFVLGSVINLSGQVKFSDG
SIAAGAAVYARTSSGSATYRATTDAAGMYSLQFIPGTYSVGVEFTSPGFTGTALVVSSRA
FSTSSTLDLTTQDIQLNGRVVNNSGQPVANVYLRGGVHRNNGWNGLSPVSGADGRFQVRM
LPATYLSMKLEPPPGSPYAVTPLPNQTFSGNTTQDFVLGSVISLSGQVKFSDGSIAAGVS
VYAKEPSSPTATYQATTDAAGMYSLQLIPGTYSVGIEFASPSFTGSKTLLFSQPFSTPST
LNLTAQDIQLNGRVVNSSGQPVANVRLWGSMYRDNGWNALSPLSGADGRFQVRMFPGTYS
SMQLEPYTPAYLMAPLPAQTFSASLSQEFVISDTNECMVNNGGCNVNATCTNLPGSRTCA
CNSGYTGDGISCVEENPAALTVTSPNGGEQWSTGSVRNITWTSSRVSQVNLRYSFDNGAT
WTLIAANVPAGLGSYAWTLPASTSSNALVRIADAQNSNLMDTSNAKFTVTSGRVILNEIL
ANEPGSATAGEFVELVNVGSTAMDLSGWVLWDATAVRHTFASGTVLAPGKALVVFGAASG
IPLCSCTSNAVAATTGSLSLGNTGDTVTVKNAAGTVIDTFTYSSALAAADGVSMNHSPDA
QPVGSFVLHNTLSPLSASAGKRANGSSF
Download sequence
Identical sequences Q090Y4
gi|310821170|ref|YP_003953528.1| WP_002614140.1.13107 WP_002614140.1.14028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]