SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|310822016|ref|YP_003954374.1| from Stigmatella aurantiaca DW4/3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310822016|ref|YP_003954374.1|
Domain Number 1 Region: 297-564,626-667
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.33e-83
Family Type II chitinase 0.00000426
Further Details:      
 
Domain Number 2 Region: 107-292
Classification Level Classification E-value
Superfamily Fibronectin type III 4.45e-30
Family Fibronectin type III 0.0000373
Further Details:      
 
Domain Number 3 Region: 54-96
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 0.0000000000000732
Family Carbohydrate binding domain 0.00023
Further Details:      
 
Domain Number 4 Region: 566-627
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000000000169
Family Chitinase insertion domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|310822016|ref|YP_003954374.1|
Sequence length 670
Comment chitinase [Stigmatella aurantiaca DW4/3-1]
Sequence
MLNTASKLRSLTSGAVLLATLVACSGEQDFSQMEGGPSFEASTNRAGIVTIAAAWAPNTA
YSAGTLVTYGGSTYKCIQSHTSLVGWEPPNVPALWELQSGGGGDTQAPSVPANLTSPSKT
STSVSLSWSASNDNVGVTGYDVYRGTALAGTTASTSFTVSGLTANTAYTFSVRAKDAAGN
VSAASNTLSVTTSAAGATCSALPSVPGGLNSPSKSSSSVSLAWSASSPGTNCSIAGYDIY
NGSTRVGQTSGTGTDFTVSGLNANTAYTFSVAARNEFGASARSAGLNVTTSPNSGGGGAI
ILGYFAQWGVYGRNYHVKNIVTSGSASKLTHINYSFGNVTNGQCVLGDTYADYDRAYTAA
ESVDGVADTWDTGALRGSFNQLRKLKKLYPNIKVLFSFGGWTWSGGFGQAAANPAAFAES
CYKLVEDPRWADVFDGIDIDWEYPNACGLSCDTSGPDAYVRLMSALRSRFGANYLVTAAV
PAGAGPINAANYGAAAQYVNWYNVMTYDFFGAFAAQGPTAPHSALYSWPGMPTSNGQDKF
YTDAAIQLFKSKGVPANKLLIGVGFYGRGWSGVPNTNGGLNQPATGAGTGTYEPGIEDYK
VLVNRCPPTGTVAGTAMAYCGGQWWSYDTPSTIAGKMTYKKNQGLGGAFFWELSGDTANG
ELINALYTNR
Download sequence
Identical sequences E3FCP9
WP_013376430.1.13107 gi|310822016|ref|YP_003954374.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]