SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|310823461|ref|YP_003955819.1| from Stigmatella aurantiaca DW4/3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310823461|ref|YP_003955819.1|
Domain Number 1 Region: 260-540,615-658
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.56e-84
Family Type II chitinase 0.00000115
Further Details:      
 
Domain Number 2 Region: 58-153
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 9.07e-25
Family Cellulose-binding domain family II 0.00038
Further Details:      
 
Domain Number 3 Region: 159-261
Classification Level Classification E-value
Superfamily Fibronectin type III 8.95e-17
Family Fibronectin type III 0.00024
Further Details:      
 
Domain Number 4 Region: 542-616
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0000000000458
Family Chitinase insertion domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310823461|ref|YP_003955819.1|
Sequence length 661
Comment chitinase [Stigmatella aurantiaca DW4/3-1]
Sequence
MVLSLPERQLVRAAFLPLLLLGLGLGSGPACTGDVSLVEETPTSFSMHSQELTGGVFTFQ
TTSVWSTGYCAQLRLTNTTGAALSQWTVTFELPPGMGITSLYNGQWSAQGQLQTVRDQGW
NGPVPVGGTVSFSFCGHHGGTAGTPFNYTLNGTPGSGSPPPPQPPTDTQPPSTVQGLSVV
SKTARSVELTWQAASDNVGVTGYEVFQNSAGTAVATPSGTSVSVGGLQPGTAYVFTVKAR
DAVGNRSAASAPLTVSTEPLAAPKHLVGYFVSWGLYQRQFYAKSLDVSGAAAKLTHVNYA
FGRVVNGRCDISAGNPEADYTWSHTAAMSVDGVADAGQPLRGNFNQLKKLKAKYPHLKVL
ISLGGAEWSTGFSDAVSTAEKRRIFVQSCVDLYIRGNLPGGAGLAAGLFDGIDVDWEFPA
VNWGGQPGRPEDTVNFTEMLAEFRRQLDAVRPGLLLTMASGSSEEVFSKIQLNVIPTYLD
FITVMTYDMHGGWDPATNFHAALYNQASNPAKARRDSTHEAIQGHLAAGVPPGKLVLGIP
FYGRGWQGTQAGALGDGLYQSTAGPARGNWDVTGNSGMFDYYYIKNVLEPLGVKRRHPEA
QVPYLYNSATGLWVSYDDPVSVGVKGQYINTQQLAGAMFWDLSSDDAQGSLVAAMKAALS
P
Download sequence
Identical sequences E3FFR9
WP_013377200.1.13107 WP_013377200.1.14028 gi|310823461|ref|YP_003955819.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]