SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|310820738|ref|YP_003953096.1| from Stigmatella aurantiaca DW4/3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310820738|ref|YP_003953096.1|
Domain Number 1 Region: 289-586
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 5.81e-40
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.0014
Further Details:      
 
Domain Number 2 Region: 151-287
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.72e-33
Family Ferredoxin domains from multidomain proteins 0.00017
Further Details:      
 
Domain Number 3 Region: 77-148
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.36e-17
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|310820738|ref|YP_003953096.1|
Sequence length 628
Comment NADH dehydrogenase I subunit G [Stigmatella aurantiaca DW4/3-1]
Sequence
MSDNDTKKPTGDAQPPPKGAPTDTPAAKIGPEPSNPPAAPKADAPPVAASSTTPPKPPAP
PAGGPPKPPPPKNPGFVTCTVDGKEVVVKPGTNMIDAAKTVGSEIPYYCYHPRLSIAANC
RICLVEASNAPKMVPACQTPLAEGQVINTTSPKVKEQRRSVMEFLLLNHPVDCSICDQAG
ECKLQDYYMKYDYRPSRLEGGKALKNKRKVLGPRVVLDQERCILCTRCVRFMNEIPKEPQ
LGVFGRGSHERIDVFPGNELSSNYSLNTVDVCPVGALLSRDFRFRARAWFLSATPSVCTG
CSRGCAIYADWMSQDTYRYRPRENEAINKSWMCDQGRLSYKSLNLGRVLNASVGRRATQA
KDTAQPVLSRVEAAKAAAQALQPLAKSTKLAVLASPLLSNEDLLAGLTFAKATLGVQDVY
VGGRPQGDADHFLMTADKNPNRKGLELIARGLGLTLKPFEDLTAAIRAGKVKALYALGTE
VPSGEEAFAQAAAQLEVFVAQALSESAVTAQATVLLPVAAHIEDEGSFVQQDGIIQRFRK
AYPSKGEAVPHWRWLSEIHRALGSTQAWTSARDVFRELSAQVAEFASFNWDQASPPDREK
PGINPLPAGADGRPAGYREFGTPRVRGI
Download sequence
Identical sequences E3FCG0
WP_013375771.1.13107 gi|310820738|ref|YP_003953096.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]