SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317127080|ref|YP_004093362.1| from Bacillus cellulosilyticus DSM 2522

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317127080|ref|YP_004093362.1|
Domain Number 1 Region: 6-84
Classification Level Classification E-value
Superfamily KaiA/RbsU domain 1.44e-23
Family Phosphoserine phosphatase RsbU, N-terminal domain 0.00093
Further Details:      
 
Domain Number 2 Region: 134-334
Classification Level Classification E-value
Superfamily PP2C-like 0.0000000126
Family PP2C-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317127080|ref|YP_004093362.1|
Sequence length 337
Comment protein serine/threonine phosphatase [Bacillus cellulosilyticus DSM 2522]
Sequence
MEETRLSMYQSYKEMLTSYIKSKSEHALYSAQQFSKEMMEKDMSPEEMVSLHLSVFKEIV
DELPEEVIASFDLLLEVMIGYGLAHQEHLSLRDRQRQLDSELDVAARMQKSLLPNEQIEV
DAVDLGVVSVPAGKMSGDYYHYLSDEHGNIGIAVADVIGKGVPAAMCMSMIKYAMDSLPE
QRLQPAALLENLNRVVARNIDSDMFITMVYGTYAPREHLFYYASAGHEPGFFYEAATNTF
EDLKTKGLVLGVSPKVHYKEFSINMEPGDFIVLLSDGVTECRIHDHFLERSQISSLIGKY
KHLPAQAIAENVFRELEKIQDFELKDDFTLLILRRNV
Download sequence
Identical sequences E6TV48
WP_013486972.1.80543 gi|317127080|ref|YP_004093362.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]