SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317127302|ref|YP_004093584.1| from Bacillus cellulosilyticus DSM 2522

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|317127302|ref|YP_004093584.1|
Domain Number - Region: 68-159
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 0.00994
Family Methylesterase CheB, C-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317127302|ref|YP_004093584.1|
Sequence length 184
Comment hypothetical protein Bcell_0571 [Bacillus cellulosilyticus DSM 2522]
Sequence
MIGGKVMKRNFYFVFIGIIVVGLVSYFSLNNGESTTEGEASNIKELVHDYSTGNVGGNEV
ASITSHELIVTDSDQKETIYDLPADEFFVSIAPYVTETHPCAIHSLTGCQGELANAEFDI
YIEDEEGNVILDEAVTSLENGFIDLWLPRDKTYHSIITFDGKTVESEFSTFEGDNTCITT
MQLM
Download sequence
Identical sequences E6TYB5
gi|317127302|ref|YP_004093584.1| WP_013487194.1.80543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]