SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317127313|ref|YP_004093595.1| from Bacillus cellulosilyticus DSM 2522

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317127313|ref|YP_004093595.1|
Domain Number 1 Region: 3-159
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.00000000000000244
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317127313|ref|YP_004093595.1|
Sequence length 163
Comment transcription activator effector binding protein [Bacillus cellulosilyticus DSM 2522]
Sequence
MEKYKVVKIPAYRAIGLKWEGSWSEISGLKEVIQEAGDRREELSHIVAPVVQLGLSYHTR
QDGFTHYSAYEVTREQEVPDGMIEIDIPEMTYLVTNHKKGGNIGKTYDDIAQYLKESNYE
PYRDETVPFENLPIKHEKYPLDRDLDDPHFEILIPIEKKEKDM
Download sequence
Identical sequences E6TYC6
gi|317127313|ref|YP_004093595.1| WP_013487205.1.80543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]