SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317127724|ref|YP_004094006.1| from Bacillus cellulosilyticus DSM 2522

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317127724|ref|YP_004094006.1|
Domain Number 1 Region: 128-280
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 8.55e-26
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.042
Further Details:      
 
Domain Number 2 Region: 57-115
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000179
Family AraC type transcriptional activator 0.01
Further Details:      
 
Domain Number 3 Region: 5-55
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000166
Family AraC type transcriptional activator 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317127724|ref|YP_004094006.1|
Sequence length 281
Comment AraC family transcriptional regulator [Bacillus cellulosilyticus DSM 2522]
Sequence
MDSLEKMNGAINYIEDNLLNEIDFREVARIAQCSEYHFKRMFSFLAGVSLSEYIRRRRLT
LAAFDLKDRNEKVIDVAMKYSYHSPDSFTRAFQSLHGVTPTEARHHGHSLKAYPKMTFQL
TIKGGTEMNYRIVQKEAFRVVGWKKRINLIPQGTNPEISEMWDTISDETYTQIEALSDLT
PRGIINVCTNFSDERSQTGELDYYIAAATTKPCPNNLEELEIPAYTWAVFEVEGEWDQVQ
DAWGRIYSEWFPSSGYEHVEGPEILASKENRSEIWMTVVKK
Download sequence
Identical sequences E6U231
gi|317127724|ref|YP_004094006.1| WP_013487616.1.80543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]