SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219846988|ref|YP_002461421.1| from Chloroflexus aggregans DSM 9485

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219846988|ref|YP_002461421.1|
Domain Number 1 Region: 5-389
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 5.1e-107
Family Homocysteine S-methyltransferase 0.00000152
Further Details:      
 
Domain Number 2 Region: 347-616
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 5.49e-81
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.00054
Further Details:      
 
Domain Number 3 Region: 924-1184
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 4.05e-80
Family Methionine synthase SAM-binding domain 0.0018
Further Details:      
 
Domain Number 4 Region: 750-903
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 8.77e-36
Family Cobalamin (vitamin B12)-binding domain 0.0000657
Further Details:      
 
Domain Number 5 Region: 652-745
Classification Level Classification E-value
Superfamily Methionine synthase domain 0.00000000000000222
Family Methionine synthase domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219846988|ref|YP_002461421.1|
Sequence length 1196
Comment methionine synthase [Chloroflexus aggregans DSM 9485]
Sequence
MTRPTYLQALAERVLVYDGAMGTSIDTFDLTAEDYGGEATFGCRDYLVITRPDVIESIHT
SFLEAGCDVIETCTFQSTRLRLAEWGLGDRTIEINRAAAALARRVADRFAARDGRPRYVA
GSIGPTGKLPSSDDPELSNITFAELSDIFREQAIGLIEGGVDLLLVETSVDILEVKAALD
GIRRAKIDLNRPDIAVQAQVFLDLSGRMLLGTDVPAMIATLEAMPVDVIGLNCGTGPEHM
RAAIQYLTAHSRKPISCIPNAGLPLEVEGRTVYPMEPEPFAEVLAEFVRDYGVAVVGGCC
GTRPAHIARLRQLLGNDPTPKVRQVEYIPSVSSGIRATALRQDATLTMIGERLNTLGSRK
VKRLLLRDDYDGALEVAREQVESGAHMLDVCVAMTERSDEREQMTRLIKKLTLNIELPLV
IDTTEAEVLEAALSIYPGRALINSVSLEGGRGAKIDKVLPLAARYGAAVIAMTIDEEGMA
HTAERKVAIAERIAQIARDEYGLPAEALVFDVLTFPITTGQEELRYSAIETLEGIRLVKQ
RIPGCFTTLGVSNLSFGVAPHARAALNSVFLYHAVAAGLDTAIINPAHITPYAEIDPVQR
ELCEDLIFARRDDALARFIAYFEQHTASSDNEREDPTASMTVDQRLHWKILHRKKEGIED
DIDQAVDERLQAIGLRLSDPAAAVRDDQGASPQGRAAVEVLNNVLLPAMKEVGDLFGAGQ
LILPFVLQSAEAMKKAVARLERYLDRVEGTSKAKVVLATVYGDVHDIGKNLVNTILSNNG
YTVYDLGKQVPINTIVEKALEVQADAIGLSALLVSTSKQMPLCVQELHRRGLRIPVLVGG
AAINRQYGQRITFVDDEEPYPAGVFYCKDAFEGLETMDRLSNPATRDQFIEQTIREAANV
LHRRMTGRVALADLGEAASATAAGVRSAVRTDVPVPVPPFWGWRATSRIRLRDVVECLDR
NSLYRLQWGAKNAKGEEWERLRAEFDQKVRELIAEAERDGWLQPKVIYGYFPVQSDGLEL
IVYDPVNRSRELTRFVFPRQPARERLCISDYFRSVDSGEYDVAAFQIVTIGSTVDELVDT
LQQRGDYSRSYYIHGLGVSLAEALAEYTNRIIRQGLGLDERRGKRYSWGYPACPDLSEHA
KLWQILPGEEIGVTLTEAFQLVPEQSTAAIVVHHPEAKYFSIGSAVERAETDVQNQ
Download sequence
Identical sequences B8GC11
gi|219846988|ref|YP_002461421.1| WP_012615351.1.86148 326427.Cagg_0032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]