SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219847266|ref|YP_002461699.1| from Chloroflexus aggregans DSM 9485

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219847266|ref|YP_002461699.1|
Domain Number 1 Region: 80-200
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 1.52e-17
Family MJ1460-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219847266|ref|YP_002461699.1|
Sequence length 203
Comment bacteriochlorophyll 4-vinyl reductase [Chloroflexus aggregans DSM 9485]
Sequence
MQEVAHASDIAQIGPNSIIQTVAALREHYGAEQTAAWLRRTGRADLLERMPDHMLPESEF
GALIHDLRAWLGMPAAMRVLDRSGELTAHYVATNRVPTPIRLILPHVPIGLGLRIFLPAI
AQHAWTFAGSGRFGYSFKPSWQLTLADSIESRGVRASHPVCSYYRAAFEGLLRLVVNDRI
RVQEVACRAMGAPHCAFSITVNR
Download sequence
Identical sequences B8G2V9
326427.Cagg_0317 gi|219847266|ref|YP_002461699.1| WP_012615629.1.86148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]