SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219848175|ref|YP_002462608.1| from Chloroflexus aggregans DSM 9485

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219848175|ref|YP_002462608.1|
Domain Number 1 Region: 367-615
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 2.75e-58
Family Tetrapyrrole methylase 0.0012
Further Details:      
 
Domain Number 2 Region: 3-179,203-243
Classification Level Classification E-value
Superfamily CbiG N-terminal domain-like 7.72e-58
Family CbiG N-terminal domain-like 0.00031
Further Details:      
 
Domain Number 3 Region: 229-354
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 3.4e-32
Family CobE/GbiG C-terminal domain-like 0.00084
Further Details:      
 
Domain Number 4 Region: 633-740
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.78e-20
Family Siroheme synthase N-terminal domain-like 0.0014
Further Details:      
 
Domain Number 5 Region: 737-777
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 0.000000017
Family Siroheme synthase middle domains-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219848175|ref|YP_002462608.1|
Sequence length 778
Comment precorrin-3B C(17)-methyltransferase [Chloroflexus aggregans DSM 9485]
Sequence
MTELAIIAITRTGVELARRLARAMPATVWVPARFATDWPTARTYTTVAEAVQTAWSAARA
IVFIGAAGIIVRLIAPMLSHKTDDPAVVCLDEDGRFAVPLVGGHRAGANQLARQIAAITG
GRAAITTASDTQGLPALDLIGREAGWRIAPDSAVTHVMACLVNGEPIGVWVDPALSTARD
VLAAELAAVPVVEWVSEPSTLANDYFAAAIVVSHRRLADLWETLRPKALRYLPPVLAVGI
GCRRETPAGELAEALATTLAEADLLPECVATIATAELKATEPGIIALAAQLGVPLTIIST
EQLRALDPESFSPSAAGRFELPGVAEPCAVVAAHGPLLAPKRSFARCTVAVALRAPVANP
CDAAPAAGQLALVSIGPGDLSQLTVAARQALANADVVTGYGRYIDLIRPLLRANQEVIAT
PAMGDEMGRARAAIELARAGRRVALVSSGDIGIYAMAAPVFETLHAEGWTGRDPVVEVIP
GVSAFQALAARLGAPVNHDLCLISLSDLLTPWPLIERRLRAAAQADFVIALYNPRSQGRN
WQLAAAIAIVRDHRPPHTPVAFGRQVTRADEQIMLTTLAEVDPEQADMLTVVLIGNSQSF
ALAGHVVTPRGYTNRTAAPTPTTAASPVPDYPIVLTKSSHMPAVVIGGGAVGERKVRSLL
AAGFPVRLISPTVTPQLAEWASAGKLIWEKRSYQAGDLTGARLVFAATDDRTVNARIAAA
ASAAGALCNVADDPSAGDFHVPAIHRSGGITIAVSSNGAAPARAAAIRDAIAEWLAEA
Download sequence
Identical sequences B8G7Z3
WP_012616536.1.86148 326427.Cagg_1264 gi|219848175|ref|YP_002462608.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]