SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219848309|ref|YP_002462742.1| from Chloroflexus aggregans DSM 9485

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219848309|ref|YP_002462742.1|
Domain Number 1 Region: 139-448
Classification Level Classification E-value
Superfamily TPR-like 2.91e-53
Family Tetratricopeptide repeat (TPR) 0.0021
Further Details:      
 
Domain Number 2 Region: 9-177
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 4.18e-36
Family Protein prenylyltransferase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219848309|ref|YP_002462742.1|
Sequence length 450
Comment hypothetical protein Cagg_1399 [Chloroflexus aggregans DSM 9485]
Sequence
MNLDSLYQDRREAALADFNRAIAIDPDYAWAYFQRGQVLRELGRMEESLADLRRACELEP
NDAAYHAERGETLRLMRRYEEALTAFSRAIELRPEYPWALGSRGQVWRALRRHHEALADF
EAALALNPMLAWVHAERGETLRALRRLHEAIEAFNQALNIDPDYVWALGHRGIAYRELRD
YPAAIADFDAAITLQDTIAWLYAERGETRRLADDFEGALFDLNRAIELDPQYAWALGSRG
ATFRALGDTEAALADFNRALELDPAYEWVYMQRGLLYRNLDRLDEALADFSRVLALNPNN
VGALVERGELLRLRRHYNEALTDFSHAIELQPDHAWAIGSRGQVYRALNRYHEALADFNN
ALEQKPDLVWILAERGETYRLLHQYNEALEDFNRALELQPNDSWVLSRRGATYQALKIFE
EAYIDLTRAIEIDPNNAWALAQRGSLFRQM
Download sequence
Identical sequences B8G8P4
gi|219848309|ref|YP_002462742.1| 326427.Cagg_1399 WP_012616670.1.86148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]