SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219848564|ref|YP_002462997.1| from Chloroflexus aggregans DSM 9485

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219848564|ref|YP_002462997.1|
Domain Number 1 Region: 2-548
Classification Level Classification E-value
Superfamily Urocanase 3.4e-246
Family Urocanase 0.000000000000916
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219848564|ref|YP_002462997.1|
Sequence length 550
Comment urocanate hydratase [Chloroflexus aggregans DSM 9485]
Sequence
MSRIIRAPRGTTLTCANWQIEAAYRMIQNNLDPDVAFDPEHLIVYGGRGRAARNWACFDA
ILATLRRLQPDETLIVQSGKPVAVFRTHLDAPRVLIANAHLVPAWATQANFDRWEAAGLT
MYGQMTAGSWIYIGTQGILQGTYETFGALARSAGWGTLRGKLVVTAGLGEMGGAQPLAVT
LNEGVIIAVEVDRWRAERRLRLRQVDRLSDDLEEAMTWAEEARAAGTPLSIALIGNASEV
LPEMLRRGVTPDVATDQTSAHDVRYGYIPAGLSLAEAAALRERDPDEYDRRVLESMAEHV
RVLLEWQRRGCIVFDYGNNLRQRAFDAGVKDAFSYPGFVPAYIRPLFCEGKGPFRWVALS
GDPEDIYVTDGAISELFPDNEHLGRWLRLAREYVTFQGLPARICWLGYGERAKAGLLLND
LVARGAVKAPIVIGRDHLDAGSVASPNRETEGMRDGSDAIADWPLLNALLNAVGGATWVS
IHHGGGVGIGYSIHAGQVIVADGTPEAARRIERVLTTDPGMGVVRHADAGYPEAIAFARR
HGIDMPMLGQ
Download sequence
Identical sequences B8GA46
326427.Cagg_1660 WP_015940420.1.86148 gi|219848564|ref|YP_002462997.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]