SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219849204|ref|YP_002463637.1| from Chloroflexus aggregans DSM 9485

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219849204|ref|YP_002463637.1|
Domain Number 1 Region: 14-397
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 3.53e-110
Family ArgJ-like 0.0000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219849204|ref|YP_002463637.1|
Sequence length 398
Comment arginine biosynthesis bifunctional protein ArgJ [Chloroflexus aggregans DSM 9485]
Sequence
MNFTIFEDGHIASPTGFRATGISAGLKEGSKARDLALIYSQYPCRAAALFTTSVFKAAPV
FLSQAILLRNHDAIRAVLINAGQANAGTGQAGLNDAIECAKITADELEIPRDSVLLMSTG
LIGVPLPMQRMRNGIRRAVSELDSNGGRRAALAILTTDTRPKERVLRVSLRNGPRFTLAG
MAKGTRMIHPRLATVLVLITTDLAISQPLLQRALHHSVERSFNRLNIDGDRSPNDSVIML
ANGAIDHPPITDSSTWEYGVFQEALDYLCADLAGQIVRDAAGSGKVIKVVVQGAPDGAMA
QTIANAVARSGSVRAACRRNSSDWGALLAAIGASAVELRPDLLDLQIGTVPVMTRGTPVP
FDPTTLVQAMSGPEVELIIDLNLGPAETTVWTCTWTDG
Download sequence
Identical sequences B8GDD4
gi|219849204|ref|YP_002463637.1| 326427.Cagg_2322 WP_015941059.1.86148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]