SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219849434|ref|YP_002463867.1| from Chloroflexus aggregans DSM 9485

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219849434|ref|YP_002463867.1|
Domain Number 1 Region: 117-199,230-405,528-657
Classification Level Classification E-value
Superfamily Subtilisin-like 2.88e-56
Family Subtilases 0.00025
Further Details:      
 
Domain Number 2 Region: 443-525
Classification Level Classification E-value
Superfamily PA domain 0.00000000523
Family PA domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219849434|ref|YP_002463867.1|
Sequence length 1049
Comment peptidase S8/S53 subtilisin kexin sedolisin [Chloroflexus aggregans DSM 9485]
Sequence
MIATPKRQLIALAVSLLLTMALVTPSTAQPPRPIPNLDALRLDEPVTIDQAPIKLSPSLV
NVTGRHAVVIRLSENPTARIPQGAAQVAQLNRISQQQERVLARLRAIDPTLTELARLRVA
LNAVIVEVDGAALPALARDIEVVRINPVVDYERADQPPMETVPYIGATPEVQAAGYRGKD
VRVAVLDSGIDYTHAAFGGPGTLEAYQAAYGTNPSDSRNKTLDGLFPTDRVKGGYDFVGE
VWPNGPLMPDPDPIDCGVSGLSSGTCAGGHGTHVADIIGGQQGVAPEVDLFAVKVCSAVS
SSCSGVAILQGLDWVADPNGDGITDDHMHIVNMSLGASYGQNYDDDSAIAVDNLQPLGIL
VVASAGNSSDRPYITGTPAGARTALSVAQTAVPSDSSYPITVLSTTVYGVAQPWAPIPST
AVSGILVYGASLGNALGCTAYPPGSLTGRILLVDRGTCAISIKGSNGAAAGAVAVIVANN
VAGAVPPTFSFGGGSPTVPVLSITQTAGNALKARVNNSATVDFANPVSNAGSVVGTSSRG
PTMGQMTYGNQIMYGQIIKPEIGAPGASISAVAGSGTGVEPFGGTSGAAPMVAGAAALLY
NASNWSLSPWELKARLINTAETNIYNGPPVFVGPTLAPITRIGGGEVRINRAIAAQAGAW
ELSNGAATISFGLVEVTRNPTTLRRTIVVRNYGDTSLTYTITPTFRFANDAASGAITPGT
SVTTITVPPRSRRTFTLTLRIDPTKLPAWVLNSGLNGGNGAALTAVEYDGYLVLDAPGTT
NDLTMPWHVLPRAAGNVSAPASVRATTSSPAMARLTNTGANPVSVDPFTLIGSNNTVNAS
LGAGMQMPPMDLRYVGVRAFDGTGVCPANSPIIQFAVTTHQRITHSNYPVEIDLLFDTNR
DGTPDYVGYTAEVGSFASDGRNAFFVGPVGGPYSAFFFTSHATNSTNTVVTLCGSQIGVT
ALGQQINVDAYTYDNYFTGFELSKIEGMSTVLGAPRFDIDIGSGVVPANGSLTTTVYRFN
APSDVTDSGILLQYSFAPAGREASAIIVR
Download sequence
Identical sequences B8G429
gi|219849434|ref|YP_002463867.1| 326427.Cagg_2562 WP_015941289.1.86148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]