SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219849629|ref|YP_002464062.1| from Chloroflexus aggregans DSM 9485

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|219849629|ref|YP_002464062.1|
Domain Number - Region: 1-112
Classification Level Classification E-value
Superfamily L-aspartase-like 0.0777
Family HAL/PAL-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219849629|ref|YP_002464062.1|
Sequence length 149
Comment hypothetical protein Cagg_2763 [Chloroflexus aggregans DSM 9485]
Sequence
MEYAALELLHAGDHMTAQVPRLVHPHDDEPLAAAIARALHSSAVDYRQFTDLSELLARDA
YLAEQVQELRQAWAITPPPATSVMARFRRRLAWWLFGPELAQINATHATLTRIVESLIAH
LDTERALRQALSERLAALEQGHASSQHHP
Download sequence
Identical sequences B8G5C0
WP_015941483.1.86148 326427.Cagg_2763 gi|219849629|ref|YP_002464062.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]