SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219847790|ref|YP_002462223.1| from Chloroflexus aggregans DSM 9485

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219847790|ref|YP_002462223.1|
Domain Number 1 Region: 22-252
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.99e-52
Family Extended AAA-ATPase domain 0.000000318
Further Details:      
 
Domain Number 2 Region: 258-332
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.72e-25
Family Helicase DNA-binding domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219847790|ref|YP_002462223.1|
Sequence length 350
Comment Holliday junction DNA helicase RuvB [Chloroflexus aggregans DSM 9485]
Sequence
MSAERLVNPHSDSDDQQVEKSLRPRTLSEFIGQEKVVEQLRIAIAAARGRNEALDHTLFY
GPPGLGKTSLANVVANEMGAKIKITSGPAIERAGDLAAILTNLQPNDVLFIDEVHRLNRA
VEEVLYPAMEDFALDLVVGKGPGARSLRLNLPRFTVIGATTRLALLTSPLRDRFVAVHRL
VFYSDAAMTEIVSRSARILGVPISPEGAREIGRRARGTPRIANRILRRVRDYAQVVANGE
ITLAVAREALAQLEIDELGLDENDRRLLRAIIELFNGGPVGLNTLAAALAEEVDAIEDVY
EPFLLQLGFLQRTPRGRVATRRAYEHLGLPFPERSLPLEDESGPQQGTLF
Download sequence
Identical sequences B8G5S6
326427.Cagg_0868 gi|219847790|ref|YP_002462223.1| WP_012616153.1.86148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]