SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|195978438|ref|YP_002123682.1| from Streptococcus equi subsp. zooepidemicus MGCS10565

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|195978438|ref|YP_002123682.1|
Domain Number 1 Region: 82-230
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 2.48e-37
Family PA2201 C-terminal domain-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|195978438|ref|YP_002123682.1|
Sequence length 231
Comment hypothetical protein Sez_1333 [Streptococcus equi subsp. zooepidemicus MGCS10565]
Sequence
MFHQCVIESDLEKIEDLVKDERNGIQKSKIDNQQVIHNTKRWMARDLFKIFKATYSAGYP
ISEVKKAFLDYLDVKCQVLDGQVAYLNDLDIISIAILLDIDTETIAPFIDNIGQVGYDDF
LIDFLIRWYRPEWKQHDDISFKRPYGHAQKIIQAPDKEQALGFLRNYIFSKWYAGSNDAP
WYNSHKAKNPAFHVGYWSFESGAMAKILELDDSSLKDQQYYPYDLVHWKNV
Download sequence
Identical sequences B4U3V2
552526.Sez_1333 gi|195978438|ref|YP_002123682.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]