SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218249360|ref|YP_002374910.1| from Borrelia burgdorferi ZS7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218249360|ref|YP_002374910.1|
Domain Number 1 Region: 69-142
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.22e-25
Family Ribosomal protein L11, C-terminal domain 0.00013
Further Details:      
 
Domain Number 2 Region: 4-74
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 2.09e-23
Family Ribosomal L11/L12e N-terminal domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218249360|ref|YP_002374910.1|
Sequence length 143
Comment ribosomal protein L11 [Borrelia burgdorferi ZS7]
Sequence
MAKKKAISWIKLQVPAAQAAPGAKIGQALGPHGVSGPQFVKEFNERTAKMDPGIVVPVII
TVYSDKSFSFIVKTPPASILIKKAIGIESGSKKSNTDKVGTISKEKLMEIARIKMSDLNA
KSESAAFKIIAGSARSMGVEVEK
Download sequence
Identical sequences A0A0E1UA82 A0A2J9PBX9 B7J1W5 O51354
gi|530321306|ref|YP_008407572.1| gi|15594738|ref|NP_212527.1| NP_212527.1.46978 WP_002657853.1.100172 WP_002657853.1.100372 WP_002657853.1.1709 WP_002657853.1.18535 WP_002657853.1.22354 WP_002657853.1.23946 WP_002657853.1.24131 WP_002657853.1.31711 WP_002657853.1.3534 WP_002657853.1.35366 WP_002657853.1.44797 WP_002657853.1.53248 WP_002657853.1.54040 WP_002657853.1.58911 WP_002657853.1.6933 WP_002657853.1.72823 WP_002657853.1.75039 WP_002657853.1.7957 WP_002657853.1.85076 WP_002657853.1.86244 WP_002657853.1.91101 WP_002657853.1.95407 WP_002657853.1.96757 224326.BB0393 445985.BbuZS7_0395 gi|218249360|ref|YP_002374910.1| gi|387827306|ref|YP_005806588.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]