SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|57237617|ref|YP_178865.1| from Campylobacter jejuni RM1221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|57237617|ref|YP_178865.1|
Domain Number 1 Region: 23-257
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.65e-85
Family Phosphate binding protein-like 0.0000045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|57237617|ref|YP_178865.1|
Sequence length 257
Comment NLPA family lipoprotein [Campylobacter jejuni RM1221]
Sequence
MKIKSLFIASILTLSLNANALETITVAATPVPHAEILEQVKPDLEKQGYKLEIKEFTDYV
LPNLAVDNGEADANFFQHTPYLEEFNKNKGTKLIKVAAIHIEPMAVYSKKYKSLDDIKEG
VKIAIPNDPTNESRALDIIAKKGLVKFKDKALKTPLDFIDNPKKIKFVELKPAQLPRALN
DVDFAVINSNYALSANLNPAKDSVFIEDKESPYANILVVRVGHENDPKIKALIQALQSDK
IKQFIIEKYNGSVLPAF
Download sequence
Identical sequences A0A291TT58
WP_011049780.1.26811 WP_011049780.1.41676 WP_011049780.1.77662 gi|384443139|ref|YP_005659391.1| 195099.CJE0863 gi|57237617|ref|YP_178865.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]